SCOPe 2.06: Domain d2pu0a2: 2pu0 A:1-138

Lineage for d2pu0a2 (2pu0 A:1-138)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Enolase [54828] (10 species)

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [160264] (6 PDB entries)

8. Domain d2pu0a2: 2pu0 A:1-138 [149847]
   Other proteins in same PDB: d2pu0a1, d2pu0a3
   automated match to d1oepa2
   complexed with edo, pah, zn

Details for d2pu0a2

PDB Entry: 2pu0, 1.9 Å

PDB Description: crystal structure of the t. brucei enolase complexed with phosphonoacetohydroxamate (pah), his156-in conformation

PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d2pu0a2:

Sequence; same for both SEQRES and ATOM records:

>d2pu0a2 d.54.1.1 (A:1-138) Enolase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mtiqkvhgrevldsrgnptvevevttekgvfrsavpsgastgvyeacelrdgdkkryvgk
gclqavknvnevigpaligrdelkqeeldtlmlrldgtpnkgklganailgcsmaiskaa
aaakgvplyrylaslagt

Timeline for d2pu0a2:

• d2pu0a2 first appeared in SCOP 1.75
  
• d2pu0a2 appears in SCOPe 2.05
  
• d2pu0a2 appears in SCOPe 2.07
  
• d2pu0a2 appears in the current release, SCOPe 2.08