Lineage for d3sdha_ (3sdh A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 61Protein Hemoglobin I [46464] (2 species)
  7. 62Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (10 PDB entries)
  8. 63Domain d3sdha_: 3sdh A: [14984]

Details for d3sdha_

PDB Entry: 3sdh (more details), 1.4 Å

PDB Description: high resolution crystallographic analysis of a cooperative dimeric hemoglobin

SCOP Domain Sequences for d3sdha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdha_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis)}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgnvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOP Domain Coordinates for d3sdha_:

Click to download the PDB-style file with coordinates for d3sdha_.
(The format of our PDB-style files is described here.)

Timeline for d3sdha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3sdhb_