![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins) lack the first helix (A) |
![]() | Protein Protozoan/bacterial hemoglobin [46460] (6 species) |
![]() | Species Green alga (Chlamydomonas eugametos) [TaxId:3054] [46462] (2 PDB entries) Globin li637 |
![]() | Domain d1dlya_: 1dly A: [14983] complexed with cyn, edo, hem, so4 |
PDB Entry: 1dly (more details), 1.8 Å
SCOPe Domain Sequences for d1dlya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dlya_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Green alga (Chlamydomonas eugametos) [TaxId: 3054]} slfaklggreaveaavdkfynkivadptvstyfsntdmkvqrskqfaflayalggasewk gkdmrtahkdlvphlsdvhfqavarhlsdtltelgvppeditdamavvastrtevlnmpq q
Timeline for d1dlya_: