SCOPe 2.01: Domain d1dlya_: 1dly A:

Lineage for d1dlya_ (1dly A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
   lack the first helix (A)

6. Protein Protozoan/bacterial hemoglobin [46460] (6 species)

7. Species Green alga (Chlamydomonas eugametos) [TaxId:3054] [46462] (2 PDB entries)
   Globin li637

8. Domain d1dlya_: 1dly A: [14983]
   complexed with cyn, edo, hem, so4

Details for d1dlya_

PDB Entry: 1dly, 1.8 Å

PDB Description: x-ray crystal structure of hemoglobin from the green unicellular alga chlamydomonas eugametos

PDB Compounds: (A:) hemoglobin

SCOPe Domain Sequences for d1dlya_:

Sequence; same for both SEQRES and ATOM records:

>d1dlya_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Green alga (Chlamydomonas eugametos) [TaxId: 3054]}
slfaklggreaveaavdkfynkivadptvstyfsntdmkvqrskqfaflayalggasewk
gkdmrtahkdlvphlsdvhfqavarhlsdtltelgvppeditdamavvastrtevlnmpq
q

Timeline for d1dlya_:

• d1dlya_ first appeared (with stable ids) in SCOP 1.55
  
• d1dlya_ appears in SCOP 1.75
  
• d1dlya_ appears in SCOPe 2.02
  
• d1dlya_ appears in the current release, SCOPe 2.08