Lineage for d2psmf_ (2psm F:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1703717Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 1703718Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 1703719Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 1703937Protein Interleukin-15 receptor subunit alpha [161139] (2 species)
  7. 1703951Species Mouse (Mus musculus) [TaxId:10090] [161140] (1 PDB entry)
    Uniprot Q60819 35-103
  8. 1703953Domain d2psmf_: 2psm F: [149823]
    Other proteins in same PDB: d2psma1, d2psmb_
    automated match to d2psmc1
    complexed with bam

Details for d2psmf_

PDB Entry: 2psm (more details), 2.19 Å

PDB Description: Crystal structure of Interleukin 15 in complex with Interleukin 15 receptor alpha
PDB Compounds: (F:) Interleukin-15 receptor alpha chain

SCOPe Domain Sequences for d2psmf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2psmf_ g.18.1.1 (F:) Interleukin-15 receptor subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}
tcpppvsiehadirvknysvnsreryvcnsgfkrkagtstliecvinkntnvahwttpsl
kcirdpsl

SCOPe Domain Coordinates for d2psmf_:

Click to download the PDB-style file with coordinates for d2psmf_.
(The format of our PDB-style files is described here.)

Timeline for d2psmf_: