Lineage for d1dlwa_ (1dlw A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 275721Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 275722Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 275723Family a.1.1.1: Truncated hemoglobin [46459] (1 protein)
    lack the first helix (A)
  6. 275724Protein Protozoan/bacterial hemoglobin [46460] (5 species)
  7. 275725Species Ciliate (Paramecium caudatum) [TaxId:5885] [46461] (1 PDB entry)
  8. 275726Domain d1dlwa_: 1dlw A: [14982]
    complexed with hem

Details for d1dlwa_

PDB Entry: 1dlw (more details), 1.54 Å

PDB Description: x-ray crystal structure of truncated hemoglobin from p.caudatum.

SCOP Domain Sequences for d1dlwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlwa_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Ciliate (Paramecium caudatum)}
slfeqlggqaavqavtaqfyaniqadatvatffngidmpnqtnktaaflcaalggpnawt
grnlkevhanmgvsnaqfttvighlrsaltgagvaaalveqtvavaetvrgdvvtv

SCOP Domain Coordinates for d1dlwa_:

Click to download the PDB-style file with coordinates for d1dlwa_.
(The format of our PDB-style files is described here.)

Timeline for d1dlwa_: