Lineage for d2prrk_ (2prr K:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1100583Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 1100584Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 1100640Family a.152.1.3: Atu0492-like [140970] (6 proteins)
    duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family
  6. 1100665Protein Uncharacterized protein Reut_A2532 [158825] (1 species)
  7. 1100666Species Ralstonia eutropha [TaxId:106590] [158826] (1 PDB entry)
    Uniprot Q46Y90 5-194
  8. 1100677Domain d2prrk_: 2prr K: [149813]
    automated match to d2prra1
    complexed with peg, pge

Details for d2prrk_

PDB Entry: 2prr (more details), 2.15 Å

PDB Description: crystal structure of alkylhydroperoxidase ahpd core: uncharacterized peroxidase-related protein (yp_296737.1) from ralstonia eutropha jmp134 at 2.15 a resolution
PDB Compounds: (K:) Alkylhydroperoxidase AhpD core: uncharacterized peroxidase-related protein

SCOPe Domain Sequences for d2prrk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2prrk_ a.152.1.3 (K:) Uncharacterized protein Reut_A2532 {Ralstonia eutropha [TaxId: 106590]}
rpahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhdalm
lkdggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadippr
qramldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantigmrp
ndefflmgrvp

SCOPe Domain Coordinates for d2prrk_:

Click to download the PDB-style file with coordinates for d2prrk_.
(The format of our PDB-style files is described here.)

Timeline for d2prrk_: