SCOP 1.75: Domain d2prrk1: 2prr K:5-193

Lineage for d2prrk1 (2prr K:5-193)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.152: AhpD-like [69117] (1 superfamily)
   multihelical; contains 4-helical bundle and 2-helical arm

4. Superfamily a.152.1: AhpD-like [69118] (4 families)
   probable biological unit contains six domains of this fold arranged with 32 symmetry

5. Family a.152.1.3: Atu0492-like [140970] (5 proteins)
   duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family

6. Protein Uncharacterized protein Reut_A2532 [158825] (1 species)

7. Species Ralstonia eutropha [TaxId:106590] [158826] (1 PDB entry)
   Uniprot Q46Y90 5-194

8. Domain d2prrk1: 2prr K:5-193 [149813]
   automatically matched to 2PRR A:5-194
   complexed with peg, pge

Details for d2prrk1

PDB Entry: 2prr, 2.15 Å

PDB Description: crystal structure of alkylhydroperoxidase ahpd core: uncharacterized peroxidase-related protein (yp_296737.1) from ralstonia eutropha jmp134 at 2.15 a resolution

PDB Compounds: (K:) Alkylhydroperoxidase AhpD core: uncharacterized peroxidase-related protein

SCOP Domain Sequences for d2prrk1:

Sequence; same for both SEQRES and ATOM records:

>d2prrk1 a.152.1.3 (K:5-193) Uncharacterized protein Reut_A2532 {Ralstonia eutropha [TaxId: 106590]}
ahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhdalmlk
dggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadipprqr
amldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantigmrpnd
efflmgrvp

Timeline for d2prrk1:

• d2prrk1 is new in SCOP 1.75
  
• d2prrk1 is called d2prrk_ in SCOPe 2.01
  
• d2prrk1 appears in the current release, SCOPe 2.08, called d2prrk_