Lineage for d2pqrb1 (2pqr B:5-128)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775786Superfamily a.118.8: TPR-like [48452] (8 families) (S)
  5. 775787Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (17 proteins)
  6. 775817Protein Mitochondria fission protein Fis1 [101417] (2 species)
  7. 775818Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140836] (3 PDB entries)
    Uniprot P40515 1-138
  8. 775819Domain d2pqrb1: 2pqr B:5-128 [149793]
    automatically matched to d1y8ma1
    complexed with au

Details for d2pqrb1

PDB Entry: 2pqr (more details), 1.88 Å

PDB Description: crystal structure of yeast fis1 complexed with a fragment of yeast caf4
PDB Compounds: (B:) Mitochondria fission 1 protein

SCOP Domain Sequences for d2pqrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dfwptlkdayeplypqqleilrqqvvseggptatiqsrfnyawglikstdvnderlgvki
ltdiykeaesrrreclyyltigcyklgeysmakryvdtlfehernnkqvgalksmvedki
qket

SCOP Domain Coordinates for d2pqrb1:

Click to download the PDB-style file with coordinates for d2pqrb1.
(The format of our PDB-style files is described here.)

Timeline for d2pqrb1: