SCOP 1.75: Domain d2pqna1: 2pqn A:4-129

Lineage for d2pqna1 (2pqn A:4-129)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (8 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (17 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Mitochondria fission protein Fis1 [101417] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140836] (3 PDB entries)
   Uniprot P40515 1-138

8. Domain d2pqna1: 2pqn A:4-129 [149792]
   automatically matched to d1y8ma1

Details for d2pqna1

PDB Entry: 2pqn, 2.15 Å

PDB Description: crystal structure of yeast fis1 complexed with a fragment of yeast mdv1

PDB Compounds: (A:) Mitochondria fission 1 protein

SCOP Domain Sequences for d2pqna1:

Sequence; same for both SEQRES and ATOM records:

>d2pqna1 a.118.8.1 (A:4-129) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vdfwptlkdayeplypqqleilrqqvvseggptatiqsrfnyawglikstdvnderlgvk
iltdiykeaesrrreclyyltigcyklgeysmakryvdtlfehernnkqvgalksmvedk
iqketl

Timeline for d2pqna1:

• d2pqna1 is new in SCOP 1.75
  
• d2pqna1 is called d2pqna_ in SCOPe 2.01
  
• d2pqna1 appears in the current release, SCOPe 2.08, called d2pqna_