Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins) barrel, closed; n=5, S=10 |
Protein Replication protein A 32 KDa subunit (RPA32) fragment [50269] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50270] (5 PDB entries) |
Domain d2pqac_: 2pqa C: [149790] Other proteins in same PDB: d2pqab_, d2pqad_ automated match to d1l1ob_ |
PDB Entry: 2pqa (more details), 2.5 Å
SCOPe Domain Sequences for d2pqac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pqac_ b.40.4.3 (C:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]} qhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmd vrqwvdtddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevi nahmvls
Timeline for d2pqac_: