Lineage for d2ppfb2 (2ppf B:167-340)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043852Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2044087Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2044155Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (31 PDB entries)
    Uniprot P38501
  8. 2044183Domain d2ppfb2: 2ppf B:167-340 [149778]
    automated match to d1j9qa2
    complexed with act, cu, cu1, no, trs; mutant

Details for d2ppfb2

PDB Entry: 2ppf (more details), 1.65 Å

PDB Description: reduced mutant d98n of afnir exposed to nitric oxide
PDB Compounds: (B:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2ppfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ppfb2 b.6.1.3 (B:167-340) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt

SCOPe Domain Coordinates for d2ppfb2:

Click to download the PDB-style file with coordinates for d2ppfb2.
(The format of our PDB-style files is described here.)

Timeline for d2ppfb2: