Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
Protein CD1, alpha-1 and alpha-2 domains [54456] (4 species) Class I MHC-related |
Species Human (Homo sapiens), CD1d [TaxId:9606] [160079] (2 PDB entries) Uniprot P15813 24-201 |
Domain d2po6e2: 2po6 E:6-183 [149714] Other proteins in same PDB: d2po6a1, d2po6b1, d2po6e1, d2po6f1 automatically matched to 1ZT4 A:6-183 complexed with agh, man, nag |
PDB Entry: 2po6 (more details), 3.2 Å
SCOP Domain Sequences for d2po6e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2po6e2 d.19.1.1 (E:6-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1d [TaxId: 9606]} rlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwet lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdils fqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk
Timeline for d2po6e2:
View in 3D Domains from other chains: (mouse over for more information) d2po6a1, d2po6a2, d2po6b1, d2po6f1 |