SCOP 1.75: Domain d2po6e1: 2po6 E:184-277

Lineage for d2po6e1 (2po6 E:184-277)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein CD1, alpha-3 domain [88615] (4 species)

7. Species Human (Homo sapiens), CD1d [TaxId:9606] [158876] (2 PDB entries)
   Uniprot P15813 202-295

8. Domain d2po6e1: 2po6 E:184-277 [149713]
   Other proteins in same PDB: d2po6a2, d2po6b1, d2po6e2, d2po6f1
   automatically matched to 1ZT4 A:184-277
   complexed with agh, man, nag

Details for d2po6e1

PDB Entry: 2po6, 3.2 Å

PDB Description: crystal structure of cd1d-lipid-antigen complexed with beta-2- microglobulin, nkt15 alpha-chain and nkt15 beta-chain

PDB Compounds: (E:) T-cell surface glycoprotein CD1d

SCOP Domain Sequences for d2po6e1:

Sequence; same for both SEQRES and ATOM records:

>d2po6e1 b.1.1.2 (E:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1d [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlyw

Timeline for d2po6e1:

• d2po6e1 is new in SCOP 1.75
  
• d2po6e1 appears in SCOPe 2.01
  
• d2po6e1 appears in the current release, SCOPe 2.08