Lineage for d2po6a2 (2po6 A:6-183)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856285Protein CD1, alpha-1 and alpha-2 domains [54456] (4 species)
    Class I MHC-related
  7. 856296Species Human (Homo sapiens), CD1d [TaxId:9606] [160079] (2 PDB entries)
    Uniprot P15813 24-201
  8. 856297Domain d2po6a2: 2po6 A:6-183 [149711]
    Other proteins in same PDB: d2po6a1, d2po6b1, d2po6e1, d2po6f1
    automatically matched to 1ZT4 A:6-183
    complexed with agh, man, nag

Details for d2po6a2

PDB Entry: 2po6 (more details), 3.2 Å

PDB Description: crystal structure of cd1d-lipid-antigen complexed with beta-2- microglobulin, nkt15 alpha-chain and nkt15 beta-chain
PDB Compounds: (A:) T-cell surface glycoprotein CD1d

SCOP Domain Sequences for d2po6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2po6a2 d.19.1.1 (A:6-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1d [TaxId: 9606]}
rlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwet
lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdils
fqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

SCOP Domain Coordinates for d2po6a2:

Click to download the PDB-style file with coordinates for d2po6a2.
(The format of our PDB-style files is described here.)

Timeline for d2po6a2: