| Class b: All beta proteins [48724] (174 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) ![]() probably related to the second domain and its superfamiy by a circular permutation |
| Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins) |
| Protein Initiation factor eIF2 gamma subunit [74964] (3 species) |
| Species Sulfolobus solfataricus [TaxId:2287] [141344] (5 PDB entries) Uniprot Q980A5 321-415 |
| Domain d2pmdb2: 2pmd B:321-415 [149667] Other proteins in same PDB: d2pmda1, d2pmda3, d2pmdb1, d2pmdb3 automatically matched to d2ahoa2 complexed with gdp, gnp, ppv |
PDB Entry: 2pmd (more details), 2.65 Å
SCOPe Domain Sequences for d2pmdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pmdb2 b.44.1.1 (B:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei
Timeline for d2pmdb2: