Lineage for d2pmda3 (2pmd A:2-206)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124645Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (3 species)
    includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family (144211)
  7. 2124654Species Sulfolobus solfataricus [TaxId:2287] [142227] (10 PDB entries)
    Uniprot Q980A5 2-206
  8. 2124659Domain d2pmda3: 2pmd A:2-206 [149665]
    Other proteins in same PDB: d2pmda1, d2pmda2, d2pmdb1, d2pmdb2
    automated match to d2qn6a3
    complexed with gdp, gnp, ppv

Details for d2pmda3

PDB Entry: 2pmd (more details), 2.65 Å

PDB Description: the structures of aif2gamma subunit from the archaeon sulfolobus solfataricus in the gdp-bound form.
PDB Compounds: (A:) Translation initiation factor 2 gamma subunit

SCOPe Domain Sequences for d2pmda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pmda3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
pvsalhkinidsliegieeyiktpy

SCOPe Domain Coordinates for d2pmda3:

Click to download the PDB-style file with coordinates for d2pmda3.
(The format of our PDB-style files is described here.)

Timeline for d2pmda3: