SCOPe 2.08: Domain d2plya1: 2ply A:392-437

Lineage for d2plya1 (2ply A:392-437)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (2 proteins)

6. Protein C-terminal fragment of elongation factor SelB [74684] (1 species)
   duplication: tandem repeat of four "winged helix" domains
7. Species Moorella thermoacetica [TaxId:1525] [74685] (4 PDB entries)

8. Domain d2plya1: 2ply A:392-437 [149651]
   automatically matched to d1lvaa1
   protein/RNA complex; complexed with ca, cl, mg, na
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2plya1

PDB Entry: 2ply, 2.6 Å

PDB Description: structure of the mrna binding fragment of elongation factor selb in complex with secis rna.

PDB Compounds: (A:) Selenocysteine-specific elongation factor

SCOPe Domain Sequences for d2plya1:

Sequence, based on SEQRES records:

>d2plya1 a.4.5.35 (A:392-437) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]}
egldwqeaatraslsleetrkllqsmaaagqvtllrvendlyaist

Sequence, based on observed residues (ATOM records):

>d2plya1 a.4.5.35 (A:392-437) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]}
egldvtllrvdlyaist

Timeline for d2plya1:

• d2plya1 first appeared in SCOP 1.75
  
• d2plya1 appears in SCOPe 2.07