Lineage for d2plsg1 (2pls G:345-427)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044127Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1044128Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1044251Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins)
    Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain
  6. 1044256Protein Hypothetical protein CT0541 [160823] (1 species)
  7. 1044257Species Chlorobium tepidum [TaxId:1097] [160824] (1 PDB entry)
    Uniprot Q8KEZ1 345-428
  8. 1044264Domain d2plsg1: 2pls G:345-427 [149644]
    automatically matched to 2PLS A:345-428
    complexed with act, edo, fmt, mg

Details for d2plsg1

PDB Entry: 2pls (more details), 2.15 Å

PDB Description: structural genomics, the crystal structure of the corc/hlyc transporter associated domain of a cbs domain protein from chlorobium tepidum tls
PDB Compounds: (G:) CBS domain protein

SCOPe Domain Sequences for d2plsg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2plsg1 d.145.1.4 (G:345-427) Hypothetical protein CT0541 {Chlorobium tepidum [TaxId: 1097]}
avqredgswlldgliavpelkdtlglravpeeekgvyhtlsgmimwllgrlpqtgditfw
enwrlevidmdskridkvlatki

SCOPe Domain Coordinates for d2plsg1:

Click to download the PDB-style file with coordinates for d2plsg1.
(The format of our PDB-style files is described here.)

Timeline for d2plsg1: