SCOP 1.75: Domain d2pllb1: 2pll B:5-313

Lineage for d2pllb1 (2pll B:5-313)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (2 families)

5. Family c.42.1.1: Arginase-like amidino hydrolases [52769] (4 proteins)
   Pfam PF00491

6. Protein Arginase [52770] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142346] (8 PDB entries)
   Uniprot P05089 5-313

8. Domain d2pllb1: 2pll B:5-313 [149635]
   automatically matched to d1wvaa1
   complexed with abh, mn

Details for d2pllb1

PDB Entry: 2pll, 1.9 Å

PDB Description: crystal structure of perdeuterated human arginase i

PDB Compounds: (B:) Arginase-1

SCOP Domain Sequences for d2pllb1:

Sequence; same for both SEQRES and ATOM records:

>d2pllb1 c.42.1.1 (B:5-313) Arginase {Human (Homo sapiens) [TaxId: 9606]}
srtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspf
qivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvd
ahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdp
gehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpat
gtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacf
glaregnhk

Timeline for d2pllb1:

• d2pllb1 is new in SCOP 1.75
  
• d2pllb1 is called d2pllb_ in SCOPe 2.01
  
• d2pllb1 appears in the current release, SCOPe 2.08, called d2pllb_