Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (3 species) includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family (144211) |
Species Sulfolobus solfataricus [TaxId:2287] [142227] (10 PDB entries) Uniprot Q980A5 2-206 |
Domain d2plfa3: 2plf A:2-206 [149627] Other proteins in same PDB: d2plfa1, d2plfa2 automated match to d2ahoa3 |
PDB Entry: 2plf (more details), 2.9 Å
SCOPe Domain Sequences for d2plfa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2plfa3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii pvsalhkinidsliegieeyiktpy
Timeline for d2plfa3: