SCOPe 2.03: Domain d2plfa2: 2plf A:321-415

Lineage for d2plfa2 (2plf A:321-415)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)

6. Protein Initiation factor eIF2 gamma subunit [74964] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [141344] (5 PDB entries)
   Uniprot Q980A5 321-415

8. Domain d2plfa2: 2plf A:321-415 [149626]
   Other proteins in same PDB: d2plfa1, d2plfa3
   automated match to d2ahoa2

Details for d2plfa2

PDB Entry: 2plf, 2.9 Å

PDB Description: The structure of aIF2gamma subunit from the archaeon Sulfolobus solfataricus in the nucleotide-free form.

PDB Compounds: (A:) Translation initiation factor 2 gamma subunit

SCOPe Domain Sequences for d2plfa2:

Sequence; same for both SEQRES and ATOM records:

>d2plfa2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

Timeline for d2plfa2:

• d2plfa2 first appeared in SCOP 1.75
  
• d2plfa2 appears in SCOPe 2.02
  
• d2plfa2 appears in SCOPe 2.04
  
• d2plfa2 appears in the current release, SCOPe 2.08