Lineage for d2pk1a1 (2pk1 A:7-337)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 812142Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
    (homo)trimer; each chain donates 3 beta-strands per turn of the helix
  4. 812143Superfamily b.108.1: Phage fibre proteins [69349] (5 families) (S)
  5. 812181Family b.108.1.5: HylP-like [159317] (1 protein)
    Pfam PF07212
  6. 812182Protein Phage-associated hyaluronidase, HylP1 [159318] (1 species)
  7. 812183Species Streptococcus pyogenes [TaxId:1314] [159319] (6 PDB entries)
    Uniprot Q9A0M7 7-336! Uniprot Q9A0M7 7-337
  8. 812189Domain d2pk1a1: 2pk1 A:7-337 [149585]
    automatically matched to 2YVV A:7-337
    complexed with asc

Details for d2pk1a1

PDB Entry: 2pk1 (more details), 3.1 Å

PDB Description: Crystal Structure of the complex of hyaluranidase trimer with ascorbic acid at 3.1 A resolution reveals the locations of three binding sites
PDB Compounds: (A:) hyaluronidase, phage associated

SCOP Domain Sequences for d2pk1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pk1a1 b.108.1.5 (A:7-337) Phage-associated hyaluronidase, HylP1 {Streptococcus pyogenes [TaxId: 1314]}
lrvqfkrmkaaewarsdvilleseigfetdtgfaragdghnrfsdlgyispldynlltnk
pnidglatkvetaqklqqkadketvytkaeskqeldkklnlkggvmtgqlkfkpaatvay
ssstggavnidlsstrgagvvvysdndtsdgplmslrtgketfnqsalfvdykgttnavn
iamrqpttpnfssalnitsgnengsamqlrgsekalgtlkithenpsigadydknaaals
idivkktngagtaaqgiyinstsgttgkllrirnlsddkfyvksdggfyaketsqidgnl
klkdptandhaatkayvdkaiselkklilkk

SCOP Domain Coordinates for d2pk1a1:

Click to download the PDB-style file with coordinates for d2pk1a1.
(The format of our PDB-style files is described here.)

Timeline for d2pk1a1:

  • d2pk1a1 is new in SCOP 1.75
  • d2pk1a1 became obsolete in SCOPe 2.01