Lineage for d2pjna1 (2pjn A:6-263)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 877482Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 877483Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) (S)
  5. 877484Family d.165.1.1: Plant cytotoxins [56372] (17 proteins)
  6. 877584Protein Ricin A-chain [56389] (1 species)
  7. 877585Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (24 PDB entries)
    Uniprot P06750 28-286
  8. 877597Domain d2pjna1: 2pjn A:6-263 [149567]
    automatically matched to d1br6a_
    complexed with so4, ure

Details for d2pjna1

PDB Entry: 2pjn (more details), 2.4 Å

PDB Description: Ricin a-chain (recombinant) complex with urea
PDB Compounds: (A:) ricin

SCOP Domain Sequences for d2pjna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pjna1 d.165.1.1 (A:6-263) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
ypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsnh
aelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnydr
leqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyie
gemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvydv
silipiialmvyrcappp

SCOP Domain Coordinates for d2pjna1:

Click to download the PDB-style file with coordinates for d2pjna1.
(The format of our PDB-style files is described here.)

Timeline for d2pjna1:

  • d2pjna1 is new in SCOP 1.75
  • d2pjna1 became obsolete in SCOPe 2.01