SCOPe 2.01: Domain d2pega_: 2peg A:

Lineage for d2pega_ (2peg A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (22 species)

7. Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (9 PDB entries)

8. Domain d2pega_: 2peg A: [149403]
   Other proteins in same PDB: d2pegb_
   automated match to d1hbha_
   complexed with hem

Details for d2pega_

PDB Entry: 2peg, 1.48 Å

PDB Description: crystal structure of trematomus bernacchii hemoglobin in a partial hemichrome state

PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d2pega_:

Sequence; same for both SEQRES and ATOM records:

>d2pega_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

Timeline for d2pega_:

• d2pega_ first appeared in SCOP 1.75, called d2pega1
  
• d2pega_ appears in SCOPe 2.02
  
• d2pega_ appears in the current release, SCOPe 2.08