Lineage for d2pega_ (2peg A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686315Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (12 PDB entries)
  8. 2686323Domain d2pega_: 2peg A: [149403]
    Other proteins in same PDB: d2pegb_
    automated match to d1hbha_
    complexed with hem

Details for d2pega_

PDB Entry: 2peg (more details), 1.48 Å

PDB Description: crystal structure of trematomus bernacchii hemoglobin in a partial hemichrome state
PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d2pega_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pega_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

SCOPe Domain Coordinates for d2pega_:

Click to download the PDB-style file with coordinates for d2pega_.
(The format of our PDB-style files is described here.)

Timeline for d2pega_: