Class a: All alpha proteins [46456] (284 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) |
Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins) lacks the first helix of canonical fold 3 helices; bundle, partly opened, right-handed twist |
Protein Lac repressor (LacR), N-terminal domain [47441] (1 species) |
Species Escherichia coli [TaxId:562] [47442] (11 PDB entries) |
Domain d2pe5b1: 2pe5 B:2-61 [149394] Other proteins in same PDB: d2pe5a2, d2pe5b2, d2pe5c2 automatically matched to d1cjga_ complexed with 145; mutant |
PDB Entry: 2pe5 (more details), 3.5 Å
SCOP Domain Sequences for d2pe5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pe5b1 a.35.1.5 (B:2-61) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkql
Timeline for d2pe5b1:
View in 3D Domains from other chains: (mouse over for more information) d2pe5a1, d2pe5a2, d2pe5c1, d2pe5c2 |