Lineage for d2pb7a1 (2pb7 A:409-615)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813146Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 813147Superfamily b.122.1: PUA domain-like [88697] (13 families) (S)
  5. 813337Family b.122.1.12: SRA domain-like [159368] (1 protein)
    Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA
  6. 813338Protein E3 ubiquitin-protein ligase UHRF1 [159369] (2 species)
  7. 813339Species Human (Homo sapiens) [TaxId:9606] [159370] (4 PDB entries)
    Uniprot Q96T88 409-615! Uniprot Q96T88 414-617
  8. 813341Domain d2pb7a1: 2pb7 A:409-615 [149351]

Details for d2pb7a1

PDB Entry: 2pb7 (more details), 1.9 Å

PDB Description: Crystal Structure of the SRA domain of the human UHRF1 protein
PDB Compounds: (A:) E3 ubiquitin-protein ligase UHRF1

SCOP Domain Sequences for d2pb7a1:

Sequence, based on SEQRES records: (download)

>d2pb7a1 b.122.1.12 (A:409-615) E3 ubiquitin-protein ligase UHRF1 {Human (Homo sapiens) [TaxId: 9606]}
ectivpsnhygpipgipvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyed
dvdhgnfftytgsggrdlsgnkrtaeqscdqkltntnralalncfapindqegaeakdwr
sgkpvrvvrnvkggknskyapaegnrydgiykvvkywpekgksgflvwryllrrdddepg
pwtkegkdrikklgltmqypegyleal

Sequence, based on observed residues (ATOM records): (download)

>d2pb7a1 b.122.1.12 (A:409-615) E3 ubiquitin-protein ligase UHRF1 {Human (Homo sapiens) [TaxId: 9606]}
ectivpsnhygpipgipvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyed
dvdhgnfftytgsggeqscdqkltntnralalncfapindqegaeakdwrsgkpvrvvrn
vkggknskyapaegnrydgiykvvkywpekgksgflvwryllrrdddepgpwtkegkdri
kklgltmqypegyleal

SCOP Domain Coordinates for d2pb7a1:

Click to download the PDB-style file with coordinates for d2pb7a1.
(The format of our PDB-style files is described here.)

Timeline for d2pb7a1: