SCOP 1.75: Domain d2p9vb1: 2p9v B:4-361

Lineage for d2p9vb1 (2p9v B:4-361)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (18 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (3 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (46 PDB entries)

8. Domain d2p9vb1: 2p9v B:4-361 [149336]
   automatically matched to d1c3ba_
   complexed with po4

Details for d2p9vb1

PDB Entry: 2p9v, 1.8 Å

PDB Description: Structure of AmpC beta-lactamase with cross-linked active site after exposure to small molecule inhibitor

PDB Compounds: (B:) Beta-lactamase

SCOP Domain Sequences for d2p9vb1:

Sequence; same for both SEQRES and ATOM records:

>d2p9vb1 e.3.1.1 (B:4-361) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d2p9vb1:

• d2p9vb1 is new in SCOP 1.75
  
• d2p9vb1 is called d2p9vb_ in SCOPe 2.01
  
• d2p9vb1 appears in the current release, SCOPe 2.08, called d2p9vb_