| Class b: All beta proteins [48724] (174 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (7 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
| Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
| Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (33 PDB entries) Uniprot P38501 |
| Domain d2p80a1: 2p80 A:12-164 [149293] Other proteins in same PDB: d2p80d1 automatically matched to d1ndra1 complexed with cu, gd |
PDB Entry: 2p80 (more details)
SCOP Domain Sequences for d2p80a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p80a1 b.6.1.3 (A:12-164) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
lprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamafngtvpgp
lmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrfkatkpgv
fvyhcappgmvpwhvvsgmngaimvlpreglhd
Timeline for d2p80a1: