SCOPe 2.08: Domain d2p7jb1: 2p7j B:181-281

Lineage for d2p7jb1 (2p7j B:181-281)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.6: Sensory domain-like [103190] (5 families)
   alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain

5. Family d.110.6.2: YkuI C-terminal domain-like [143732] (3 proteins)
   PfamB PB021678

6. Protein GGDEF family protein VP0354, C-terminal domain [419049] (1 species)
   protein is N-terminal region; consists of two sensory domain-like domains; there is a canonical sensory (PAS) domain in the middle region

7. Species Vibrio parahaemolyticus [TaxId:670] [419536] (3 PDB entries)
   Uniprot Q87SR8 207-299

8. Domain d2p7jb1: 2p7j B:181-281 [149289]
   Other proteins in same PDB: d2p7ja2, d2p7jb2
   automated match to d2p7ja1
   complexed with acy, na, so4
   missing some secondary structures that made up less than one-third of the common domain

Details for d2p7jb1

PDB Entry: 2p7j, 2.25 Å

PDB Description: Crystal structure of the domain of putative sensory box/GGDEF family protein from Vibrio parahaemolyticus

PDB Compounds: (B:) Putative sensory box/GGDEF family protein

SCOPe Domain Sequences for d2p7jb1:

Sequence; same for both SEQRES and ATOM records:

>d2p7jb1 d.110.6.2 (B:181-281) GGDEF family protein VP0354, C-terminal domain {Vibrio parahaemolyticus [TaxId: 670]}
nyspvrdfhielvkhkgfyiaspdesrlygdiipersqfnfsnmypdiwprvvseqagys
ysgehliafssikfvsneplhliidlsneqlskratrdind

Timeline for d2p7jb1:

• d2p7jb1 first appeared in SCOP 1.75
  
• d2p7jb1 appears in SCOPe 2.07