Lineage for d2p7ja2 (2p7j A:9-180)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1215605Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1216026Superfamily d.110.6: Sensory domain-like [103190] (3 families) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
  5. 1216051Family d.110.6.2: YkuI C-terminal domain-like [143732] (2 proteins)
    PfamB PB021678
  6. 1216052Protein GGDEF family protein VP0354 [160677] (1 species)
    N-terminal region, consist of two sensory domain-like domains; there is a canonical sensory (PAS) domain in the middle region
  7. 1216053Species Vibrio parahaemolyticus [TaxId:670] [160678] (1 PDB entry)
    Uniprot Q87SR8 207-299! Uniprot Q87SR8 35-206
  8. 1216055Domain d2p7ja2: 2p7j A:9-180 [149288]
    complexed with acy, na, so4

Details for d2p7ja2

PDB Entry: 2p7j (more details), 2.25 Å

PDB Description: Crystal structure of the domain of putative sensory box/GGDEF family protein from Vibrio parahaemolyticus
PDB Compounds: (A:) Putative sensory box/GGDEF family protein

SCOPe Domain Sequences for d2p7ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p7ja2 d.110.6.2 (A:9-180) GGDEF family protein VP0354 {Vibrio parahaemolyticus [TaxId: 670]}
nnventakealhqlaytgreynniqdqietisdllghsqslydylrepskanltilenmw
ssvarnqklykqirfldtsgtekvrikydfktsiagpslilrdksareyfkyaqsldneq
isawgielerdkgelvyplspslrilmpisvndvrqgylvlnvdieylssll

SCOPe Domain Coordinates for d2p7ja2:

Click to download the PDB-style file with coordinates for d2p7ja2.
(The format of our PDB-style files is described here.)

Timeline for d2p7ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p7ja1