![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.6: Sensory domain-like [103190] (5 families) ![]() alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain |
![]() | Family d.110.6.2: YkuI C-terminal domain-like [143732] (3 proteins) PfamB PB021678 |
![]() | Protein GGDEF family protein VP0354, N-terminal domain [419048] (1 species) protein is N-terminal region; consists of two sensory domain-like domains; there is a canonical sensory (PAS) domain in the middle region |
![]() | Species Vibrio parahaemolyticus [TaxId:670] [419535] (3 PDB entries) Uniprot Q87SR8 35-206 |
![]() | Domain d2p7ja2: 2p7j A:9-180 [149288] Other proteins in same PDB: d2p7ja1, d2p7jb1 complexed with acy, na, so4 |
PDB Entry: 2p7j (more details), 2.25 Å
SCOPe Domain Sequences for d2p7ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p7ja2 d.110.6.2 (A:9-180) GGDEF family protein VP0354, N-terminal domain {Vibrio parahaemolyticus [TaxId: 670]} nnventakealhqlaytgreynniqdqietisdllghsqslydylrepskanltilenmw ssvarnqklykqirfldtsgtekvrikydfktsiagpslilrdksareyfkyaqsldneq isawgielerdkgelvyplspslrilmpisvndvrqgylvlnvdieylssll
Timeline for d2p7ja2: