Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.6: Sensory domain-like [103190] (3 families) alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain |
Family d.110.6.2: YkuI C-terminal domain-like [143732] (2 proteins) PfamB PB021678 |
Protein GGDEF family protein VP0354 [160677] (1 species) N-terminal region, consist of two sensory domain-like domains; there is a canonical sensory (PAS) domain in the middle region |
Species Vibrio parahaemolyticus [TaxId:670] [160678] (3 PDB entries) Uniprot Q87SR8 207-299! Uniprot Q87SR8 35-206 |
Domain d2p7ja1: 2p7j A:181-273 [149287] complexed with acy, na, so4 |
PDB Entry: 2p7j (more details), 2.25 Å
SCOPe Domain Sequences for d2p7ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p7ja1 d.110.6.2 (A:181-273) GGDEF family protein VP0354 {Vibrio parahaemolyticus [TaxId: 670]} nyspvrdfhielvkhkgfyiaspdesrlygdiipersqfnfsnmypdiwprvvseqagys ysgehliafssikfvsneplhliidlsneqlsk
Timeline for d2p7ja1: