SCOPe 2.05: Domain d2p6ua2: 2p6u A:489-686

Lineage for d2p6ua2 (2p6u A:489-686)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.289: Sec63 N-terminal domain-like [158701] (1 superfamily)
   multihelical; consists of two helical subdomains

4. Superfamily a.289.1: Sec63 N-terminal domain-like [158702] (3 families)

5. Family a.289.1.0: automated matches [254268] (1 protein)
   not a true family
6. Protein automated matches [254621] (1 species)
   not a true protein
7. Species Archaeoglobus fulgidus [TaxId:2234] [255542] (1 PDB entry)

8. Domain d2p6ua2: 2p6u A:489-686 [149275]
   Other proteins in same PDB: d2p6ua1, d2p6ua3, d2p6ua4
   automated match to d2p6ra2
   complexed with po4

Details for d2p6ua2

PDB Entry: 2p6u, 3.14 Å

PDB Description: Apo structure of the Hel308 superfamily 2 helicase

PDB Compounds: (A:) afUHEL308 HELICASE

SCOPe Domain Sequences for d2p6ua2:

Sequence; same for both SEQRES and ATOM records:

>d2p6ua2 a.289.1.0 (A:489-686) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
dpltgfifhdvlsrmelsdigalhlicrtpdmerltvrktdswveeeafrlrkelsyyps
dfsveydwflsevktalclkdwieekdedeicakygiapgdlrrivetaewlsnamnria
eevgntsvsglterikhgvkeellelvrirhigrvrarklynagirnaedivrhrekvas
ligrgiaervvegisvks

Timeline for d2p6ua2:

• d2p6ua2 first appeared in SCOP 1.75
  
• d2p6ua2 appears in SCOPe 2.04
  
• d2p6ua2 appears in SCOPe 2.06
  
• d2p6ua2 appears in the current release, SCOPe 2.08