Lineage for d2p6ua1 (2p6u A:404-488)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. Species Archaeoglobus fulgidus [TaxId:2234] [255541] (1 PDB entry)
  8. 2694562Domain d2p6ua1: 2p6u A:404-488 [149274]
    Other proteins in same PDB: d2p6ua2, d2p6ua3, d2p6ua4
    automated match to d2p6ra1
    complexed with po4

Details for d2p6ua1

PDB Entry: 2p6u (more details), 3.14 Å

PDB Description: Apo structure of the Hel308 superfamily 2 helicase
PDB Compounds: (A:) afUHEL308 HELICASE

SCOPe Domain Sequences for d2p6ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p6ua1 a.4.5.0 (A:404-488) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
ritsklgvethlrfhslsiicdgyaktleeledffadtfffkqneislsyelervvrqle
nwgmvveaahlaptklgslvsrlyi

SCOPe Domain Coordinates for d2p6ua1:

Click to download the PDB-style file with coordinates for d2p6ua1.
(The format of our PDB-style files is described here.)

Timeline for d2p6ua1: