Lineage for d2p5wa2 (2p5w A:1-181)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182691Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2182718Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (101 PDB entries)
    Uniprot P01892 25-298
  8. 2182775Domain d2p5wa2: 2p5w A:1-181 [149261]
    Other proteins in same PDB: d2p5wa1, d2p5wb2, d2p5wb3
    automatically matched to d1akja2
    complexed with ca, epe, gol, mg, so4

Details for d2p5wa2

PDB Entry: 2p5w (more details), 2.2 Å

PDB Description: Crystal structures of high affinity human T-cell receptors bound to pMHC reveal native diagonal binding geometry
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d2p5wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p5wa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d2p5wa2:

Click to download the PDB-style file with coordinates for d2p5wa2.
(The format of our PDB-style files is described here.)

Timeline for d2p5wa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p5wa1