Lineage for d2p5lg1 (2p5l G:2-64)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2692979Family a.4.5.3: Arginine repressor (ArgR), N-terminal DNA-binding domain [46792] (2 proteins)
    automatically mapped to Pfam PF01316
  6. 2692980Protein Arginine repressor (ArgR), N-terminal DNA-binding domain [46793] (3 species)
  7. 2692988Species Bacillus subtilis [TaxId:1423] [68966] (3 PDB entries)
  8. 2692992Domain d2p5lg1: 2p5l G:2-64 [149252]
    automatically matched to d1f9nb1
    protein/DNA complex; complexed with so4

Details for d2p5lg1

PDB Entry: 2p5l (more details), 2.85 Å

PDB Description: Crystal structure of a dimer of N-terminal domains of AhrC in complex with an 18bp DNA operator site
PDB Compounds: (G:) Arginine repressor

SCOPe Domain Sequences for d2p5lg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p5lg1 a.4.5.3 (G:2-64) Arginine repressor (ArgR), N-terminal DNA-binding domain {Bacillus subtilis [TaxId: 1423]}
nkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsyk
ysl

SCOPe Domain Coordinates for d2p5lg1:

Click to download the PDB-style file with coordinates for d2p5lg1.
(The format of our PDB-style files is described here.)

Timeline for d2p5lg1: