Lineage for d2p5ka1 (2p5k A:2-64)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1258770Family a.4.5.3: Arginine repressor (ArgR), N-terminal DNA-binding domain [46792] (1 protein)
    automatically mapped to Pfam PF01316
  6. 1258771Protein Arginine repressor (ArgR), N-terminal DNA-binding domain [46793] (3 species)
  7. 1258779Species Bacillus subtilis [TaxId:1423] [68966] (3 PDB entries)
  8. 1258780Domain d2p5ka1: 2p5k A:2-64 [149249]
    automatically matched to d1f9nb1

Details for d2p5ka1

PDB Entry: 2p5k (more details), 1 Å

PDB Description: Crystal structure of the N-terminal domain of AhrC
PDB Compounds: (A:) Arginine repressor

SCOPe Domain Sequences for d2p5ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p5ka1 a.4.5.3 (A:2-64) Arginine repressor (ArgR), N-terminal DNA-binding domain {Bacillus subtilis [TaxId: 1423]}
nkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsyk
ysl

SCOPe Domain Coordinates for d2p5ka1:

Click to download the PDB-style file with coordinates for d2p5ka1.
(The format of our PDB-style files is described here.)

Timeline for d2p5ka1: