SCOPe 2.01: Domain d2p4pb_: 2p4p B:

Lineage for d2p4pb_ (2p4p B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins)
   Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain

6. Protein Hypothetical protein HD1797 [160837] (1 species)

7. Species Haemophilus ducreyi [TaxId:730] [160838] (1 PDB entry)
   Uniprot Q7VKS4 347-428

8. Domain d2p4pb_: 2p4p B: [149218]
   automated match to d2p4pa1
   complexed with ca, gol, mg

Details for d2p4pb_

PDB Entry: 2p4p, 1.8 Å

PDB Description: crystal structure of a corc_hlyc domain from haemophilus ducreyi

PDB Compounds: (B:) Hypothetical protein HD1797

SCOPe Domain Sequences for d2p4pb_:

Sequence; same for both SEQRES and ATOM records:

>d2p4pb_ d.145.1.4 (B:) Hypothetical protein HD1797 {Haemophilus ducreyi [TaxId: 730]}
dswlidgatpledvmralnihtfprdenyetiggfmmymlrkipkktdfvlydkykfeii
dtenfridqlmvsfrkd

Timeline for d2p4pb_:

• d2p4pb_ first appeared in SCOP 1.75, called d2p4pb1
  
• d2p4pb_ appears in SCOPe 2.02
  
• d2p4pb_ appears in the current release, SCOPe 2.08