SCOPe 2.04: Domain d2p4ac_: 2p4a C:

Lineage for d2p4ac_ (2p4a C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (6 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186780] (70 PDB entries)

8. Domain d2p4ac_: 2p4a C: [149209]
   Other proteins in same PDB: d2p4ab_, d2p4ad_
   automated match to d1a2wa_
   protein/RNA complex; complexed with so4

Details for d2p4ac_

PDB Entry: 2p4a, 1.9 Å

PDB Description: X-ray structure of a camelid affinity matured single-domain vhh antibody fragment in complex with RNASE A

PDB Compounds: (C:) ribonuclease pancreatic

SCOPe Domain Sequences for d2p4ac_:

Sequence; same for both SEQRES and ATOM records:

>d2p4ac_ d.5.1.1 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d2p4ac_:

• d2p4ac_ first appeared in SCOP 1.75, called d2p4ac1
  
• d2p4ac_ appears in SCOPe 2.03
  
• d2p4ac_ appears in SCOPe 2.05
  
• d2p4ac_ appears in the current release, SCOPe 2.08