Lineage for d2p49b_ (2p49 B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1289964Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (22 PDB entries)
  8. 1289966Domain d2p49b_: 2p49 B: [149207]
    Other proteins in same PDB: d2p49a_
    automated match to d1bzqk_
    protein/RNA complex; complexed with po4

Details for d2p49b_

PDB Entry: 2p49 (more details), 1.38 Å

PDB Description: Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.4A resolution: native mono_1 crystal form
PDB Compounds: (B:) antibody cab-rn05

SCOPe Domain Sequences for d2p49b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p49b_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
gsqvqlvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggt
lyadsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvt
vss

SCOPe Domain Coordinates for d2p49b_:

Click to download the PDB-style file with coordinates for d2p49b_.
(The format of our PDB-style files is described here.)

Timeline for d2p49b_: