Lineage for d2p44a_ (2p44 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1015692Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1015693Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1015694Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1015999Protein automated matches [190061] (4 species)
    not a true protein
  7. 1016000Species Cow (Bos taurus) [TaxId:9913] [186780] (69 PDB entries)
  8. 1016080Domain d2p44a_: 2p44 A: [149200]
    Other proteins in same PDB: d2p44b_
    automated match to d1a2wa_
    protein/RNA complex

Details for d2p44a_

PDB Entry: 2p44 (more details), 1.8 Å

PDB Description: Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.8A resolution: SE5A-mono-1 crystal form with five se-met sites (M34, M51, F68M, M83, L86M) in vhh scaffold
PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d2p44a_:

Sequence, based on SEQRES records: (download)

>d2p44a_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Sequence, based on observed residues (ATOM records): (download)

>d2p44a_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvac
kngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

SCOPe Domain Coordinates for d2p44a_:

Click to download the PDB-style file with coordinates for d2p44a_.
(The format of our PDB-style files is described here.)

Timeline for d2p44a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2p44b_