SCOPe 2.04: Domain d2p42b_: 2p42 B:

Lineage for d2p42b_ (2p42 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (22 PDB entries)

8. Domain d2p42b_: 2p42 B: [149195]
   Other proteins in same PDB: d2p42a_, d2p42c_
   automated match to d1bzqk_
   protein/RNA complex; complexed with mg

Details for d2p42b_

PDB Entry: 2p42, 1.8 Å

PDB Description: Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.8A resolution: SE3-mono-2 crystal form with three se-met sites (M34, M51, M83) in vhh scaffold

PDB Compounds: (B:) antibody cab-rn05

SCOPe Domain Sequences for d2p42b_:

Sequence; same for both SEQRES and ATOM records:

>d2p42b_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly
adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs
s

Timeline for d2p42b_:

• d2p42b_ first appeared in SCOP 1.75, called d2p42b1
  
• d2p42b_ appears in SCOPe 2.03
  
• d2p42b_ appears in SCOPe 2.05
  
• d2p42b_ appears in the current release, SCOPe 2.08