Lineage for d2p24a2 (2p24 A:4-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938226Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2938315Species Mouse (Mus musculus), I-AK [TaxId:10090] [88813] (7 PDB entries)
  8. 2938317Domain d2p24a2: 2p24 A:4-81 [149170]
    Other proteins in same PDB: d2p24a1, d2p24a3
    automated match to d1iaka2
    fragment; missing more than one-third of the common structure and/or sequence

Details for d2p24a2

PDB Entry: 2p24 (more details), 2.15 Å

PDB Description: I-Au/MBP125-135
PDB Compounds: (A:) H-2 class II histocompatibility antigen, A-U alpha chain

SCOPe Domain Sequences for d2p24a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p24a2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AK [TaxId: 10090]}
dhvgsygivvyqspgdigqytfefdgdelfyvdldkketiwmlpefaqlrsfdpqgglqn
iatgkhnlgvltkrsnstp

SCOPe Domain Coordinates for d2p24a2:

Click to download the PDB-style file with coordinates for d2p24a2.
(The format of our PDB-style files is described here.)

Timeline for d2p24a2: