Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Mouse (Mus musculus), I-AK [TaxId:10090] [88813] (7 PDB entries) |
Domain d2p24a2: 2p24 A:4-81 [149170] Other proteins in same PDB: d2p24a1, d2p24a3 automated match to d1iaka2 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 2p24 (more details), 2.15 Å
SCOPe Domain Sequences for d2p24a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p24a2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AK [TaxId: 10090]} dhvgsygivvyqspgdigqytfefdgdelfyvdldkketiwmlpefaqlrsfdpqgglqn iatgkhnlgvltkrsnstp
Timeline for d2p24a2: