SCOP 1.75: Domain d2oz4a2: 2oz4 A:186-282

Lineage for d2oz4a2 (2oz4 A:186-282)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (38 proteins)

6. Protein Intercellular adhesion molecule-1, ICAM-1 [49162] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49163] (7 PDB entries)

8. Domain d2oz4a2: 2oz4 A:186-282 [149100]
   Other proteins in same PDB: d2oz4a1, d2oz4h1
   automatically matched to d1p53a2
   complexed with fuc, nag, so4, trs, zn

Details for d2oz4a2

PDB Entry: 2oz4, 2.7 Å

PDB Description: structural plasticity in igsf domain 4 of icam-1 mediates cell surface dimerization

PDB Compounds: (A:) Intercellular adhesion molecule 1

SCOP Domain Sequences for d2oz4a2:

Sequence; same for both SEQRES and ATOM records:

>d2oz4a2 b.1.1.4 (A:186-282) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]}
vlpatppqlvsprvlevdtqgtvvcsldglfpvseaqvhlalgdqrlnptvtygndsfsa
kasvsvtaedegtqrltcavilgnqsqetlqtvtiys

Timeline for d2oz4a2:

• d2oz4a2 is new in SCOP 1.75
  
• d2oz4a2 appears in SCOPe 2.01
  
• d2oz4a2 appears in the current release, SCOPe 2.08