SCOPe 2.08: Domain d2oz1e1: 2oz1 E:1-150

Lineage for d2oz1e1 (2oz1 E:1-150)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.8: Di-heme cytochrome c SoxA [81677] (1 protein)
   two-domain cytochrome c with novel domain arrangement

6. Protein Di-heme cytochrome c SoxA [81678] (1 species)
   cysteine persulfide(cys sulfane) heme coordination

7. Species Rhodovulum sulfidophilum [TaxId:35806] [81679] (4 PDB entries)

8. Domain d2oz1e1: 2oz1 E:1-150 [149091]
   Other proteins in same PDB: d2oz1b_, d2oz1d_, d2oz1f_, d2oz1h_
   automated match to d1h32a1
   complexed with hec

Details for d2oz1e1

PDB Entry: 2oz1, 2.35 Å

PDB Description: The SoxAX Complex of Rhodovulum Sulfidophilum

PDB Compounds: (E:) diheme cytochrome c

SCOPe Domain Sequences for d2oz1e1:

Sequence; same for both SEQRES and ATOM records:

>d2oz1e1 a.3.1.8 (E:1-150) Di-heme cytochrome c SoxA {Rhodovulum sulfidophilum [TaxId: 35806]}
gpddplvingeieivtraptpahladrfdeirsgwtfrtddtqalemddfensgmvfvee
aravwdrpegtegkacadchgavddgmyglravypkyvesagkvrtveqminacrtsrmg
apewdyigpdmtamvaliasvsrgmpvsva

Timeline for d2oz1e1:

• d2oz1e1 first appeared in SCOP 1.75
  
• d2oz1e1 appears in SCOPe 2.07