Lineage for d2oxma1 (2oxm A:82-304)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825199Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 825200Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (4 families) (S)
  5. 825201Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 825202Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 825237Species Human (Homo sapiens) [TaxId:9606] [52144] (11 PDB entries)
  8. 825248Domain d2oxma1: 2oxm A:82-304 [149059]
    automatically matched to d1akza_
    complexed with 4mf

Details for d2oxma1

PDB Entry: 2oxm (more details), 2.5 Å

PDB Description: crystal structure of a ung2/modified dna complex that represent a stabilized short-lived extrahelical state in ezymatic dna base flipping
PDB Compounds: (A:) uracil-DNA glycosylase

SCOP Domain Sequences for d2oxma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oxma1 c.18.1.1 (A:82-304) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

SCOP Domain Coordinates for d2oxma1:

Click to download the PDB-style file with coordinates for d2oxma1.
(The format of our PDB-style files is described here.)

Timeline for d2oxma1: