Class a: All alpha proteins [46456] (284 folds) |
Fold a.284: YejL-like [158650] (1 superfamily) 6 helices; intertwined homodimer of three-helical subunits, bundle |
Superfamily a.284.1: YejL-like [158651] (1 family) |
Family a.284.1.1: YejL-like [158652] (5 proteins) Pfam PF07208; DUF1414 |
Protein Hypothetical protein CPS2611 [158653] (1 species) |
Species Colwellia psychrerythraea [TaxId:28229] [158654] (2 PDB entries) Uniprot Q481E4 7-68 |
Domain d2otab_: 2ota B: [149011] automated match to d2jr2a1 |
PDB Entry: 2ota (more details), 2.2 Å
SCOPe Domain Sequences for d2otab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otab_ a.284.1.1 (B:) Hypothetical protein CPS2611 {Colwellia psychrerythraea [TaxId: 28229]} nervekiiqdlldvlvkeevtpdlalmclgnavtniiaqvpeskrvavvdnftkalkqsv l
Timeline for d2otab_: