Lineage for d2otab_ (2ota B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 929142Fold a.284: YejL-like [158650] (1 superfamily)
    6 helices; intertwined homodimer of three-helical subunits, bundle
  4. 929143Superfamily a.284.1: YejL-like [158651] (1 family) (S)
  5. 929144Family a.284.1.1: YejL-like [158652] (5 proteins)
    Pfam PF07208; DUF1414
  6. 929145Protein Hypothetical protein CPS2611 [158653] (1 species)
  7. 929146Species Colwellia psychrerythraea [TaxId:28229] [158654] (2 PDB entries)
    Uniprot Q481E4 7-68
  8. 929148Domain d2otab_: 2ota B: [149011]
    automated match to d2jr2a1

Details for d2otab_

PDB Entry: 2ota (more details), 2.2 Å

PDB Description: crystal structure of the upf0352 protein cps_2611 from colwellia psychrerythraea. nesg target csr4.
PDB Compounds: (B:) UPF0352 protein CPS_2611

SCOPe Domain Sequences for d2otab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otab_ a.284.1.1 (B:) Hypothetical protein CPS2611 {Colwellia psychrerythraea [TaxId: 28229]}
nervekiiqdlldvlvkeevtpdlalmclgnavtniiaqvpeskrvavvdnftkalkqsv
l

SCOPe Domain Coordinates for d2otab_:

Click to download the PDB-style file with coordinates for d2otab_.
(The format of our PDB-style files is described here.)

Timeline for d2otab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2otaa1